TB-500 10mg Safety Data Sheet

This page contains the Safety Data Sheet (SDS) for N9 BIOTECH TB-500 10mg. The information provided below has been prepared to support the safe handling, storage, transport and disposal of this research material in accordance with applicable safety guidance.

SDS

Document Ref: N9TB50010/SDS

Format: PDF Document Size: ~204 KB
Regulatory Base: Prepared in accordance with UK REACH and UK CLP requirements.

Safety Data Sheet

Version 1.0

Rev. Date 03.07.2026

Document Ref N9TB50010/SDS

According to Regulation (EC) No 1907/2006 (REACH) and Regulation (EC) No 1272/2008 (CLP) as retained in UK law

1. Identification
Product Name TB-500 10mg
Chemical Name Thymosin Beta-4 Fragment (TB-500)
Sequence (Abbreviated) SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Sequence (IUPAC Condensed) Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr-Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser
CAS Number 885340-08-9
Molecular Formula C₂₁₂H₃₅₀N₅₆O₇₈S
Molecular Weight 4963.44 g/mol
Purity Refer to Certificate of Analysis
SKU TB50010
Nominal Content 10mg
Physical Form Lyophilised Solid
1.2 Relevant identified uses of the substance and uses advised against

For research use only (in vitro). Not for human or veterinary use, including diagnostic, therapeutic, prophylactic or in vivo administration of any kind. Not for use in or as a food, drug, medical device, cosmetic, household product, or any other commercial application.

1.3 Details of the supplier of the Safety Data Sheet
Name: N9 BIOTECH (Nimbus9 Group Limited)
Company No: 17199136
Address: 124 City Road
London
England
EC1V 2NX
United Kingdom
Email: support@n9biotech.uk
Telephone: +44 (0)20 3095 5435
Website: www.n9biotech.uk
Business Hours: Monday–Friday, 09:00–17:30 GMT/BST
1.4 Emergency telephone number

Emergency services (UK): 999

For medical emergencies involving chemical exposure, healthcare professionals may consult the National Poisons Information Service (NPIS).

2. Hazard(s) identification
2.1 Classification of the substance or mixture

Based on available data and supplier assessment in accordance with UK CLP (Regulation (EC) No 1272/2008 as retained in Great Britain), this substance does not meet the criteria for classification as hazardous.

2.2 Label elements
  • Hazard pictograms: None
  • Signal word: None
  • Hazard statements (H-codes): None
  • Precautionary statements (P-codes): None
2.3 Other hazards

PBT/vPvB assessment: Not applicable. The substance has not been assessed as Persistent, Bioaccumulative and Toxic (PBT) or very Persistent and very Bioaccumulative (vPvB).

No other hazards known under conditions of normal handling. As a research-use-only substance with limited published toxicological data, handle with the precautions appropriate to a substance of unknown toxicity.

3. Composition / information on ingredients

Substance type: Substance (single component)

Component CAS No EC no Concentration
Thymosin Beta-4 Fragment (TB-500) 885340-08-9 Not assigned Refer to COA
4. First-aid measures
4.1 Description of first-aid measures
General If symptoms occur or persist, consult a doctor and present this Safety Data Sheet.
Inhalation Move to fresh air. If breathing is difficult, obtain medical attention.
Skin contact Wash affected areas with soap and plenty of water. Remove contaminated clothing. Seek medical attention if irritation persists.
Eye contact Rinse cautiously with water for at least 15 minutes. Remove contact lenses if present and easy to do - continue rinsing. Seek medical attention.
Ingestion Do not induce vomiting. Rinse mouth. Do not give anything by mouth to an unconscious person. Seek medical attention immediately and present this Safety Data Sheet.
4.2 Most important symptoms and effects, acute and delayed

No specific symptoms known. As a research compound with limited toxicological characterisation, observe casualty for delayed effects.

4.3 Indication of any immediate medical attention and special treatment needed

Treat symptomatically. No specific antidote is known.

5. Fire-fighting measures
Suitable extinguishing media Use extinguishing media appropriate to surrounding fire. Suitable media include dry chemical powder, carbon dioxide (CO2), foam, or water spray.
Unsuitable extinguishing media None known.
Specific hazards from substance Combustion may produce carbon oxides (CO, CO2), Nitrogen oxides (NOx) and other irritant or toxic fumes.
Advice for firefighters Self-contained breathing apparatus and full protective clothing for firefighters.
6. Accidental release measures

Personal precautions: Wear appropriate personal protective equipment (see section 8). Avoid generation and inhalation of dust. Avoid contact with skin and eyes.

Environmental precautions: Do not allow to enter drains, sewers, or watercourses.

Containment: Collect spilled material into a sealable, labelled container. Avoid dust generation.

Cleaning up: After collection, wash the spill area with water. Dispose of waste in accordance with section 13.

7. Handling and storage
7.1 Precautions for safe handling

Handled only in a properly ventilated laboratory by trained personnel. Avoid formation of dust and aerosols. Avoid contact with skin, eyes and clothing. Wash thoroughly after handling. Do not eat, drink or smoke when using this product.

7.2 Conditions for safe storage, including any incompatibilities

Store the unopened lyophilised product in the original sealed container, protected from light and moisture. Maintain good laboratory storage practices and minimise exposure to atmospheric humidity. Prepared solutions should be stored and handled in accordance with validated laboratory procedures.

Incompatibilities: Strong oxidising agents, strong acids and strong bases. Avoid prolonged exposure to atmospheric moisture (hygroscopic).

7.3 Specific end uses

For research use only (in vitro). See section 1.2.

8. Exposure controls / personal protection
8.1 Control parameters

No occupational exposure limits (WELs, OELs, TLVs) have been established for this substance.

8.2 Exposure controls
Engineering controls Use in a fume hood or other local exhaust ventilation when handling powder. Eyewash and safety shower should be readily accessible in the work area.
Respiratory protection If handling produces dust or aerosol exceeding acceptable levels, wear a suitable particulate respirator where dust generation cannot be controlled.
Hand protection Disposable nitrile or latex laboratory gloves (EN 374). Replace immediately if contaminated.
Eye / face protection Safety glasses with side shields or chemical splash goggles (EN 166).
Skin and body protection Standard laboratory coat, closed-toe footwear.
Hygiene measures Wash hands and any exposed skin thoroughly after handling. Do not eat, drink, smoke or apply cosmetics in the work area.
9. Physical and chemical properties
Appearance Solid
Colour White to off-white
Odour Odourless to faint characteristic odour
Odour threshold Not determined
pH Not determined
Melting point / freezing point Not determined
Initial boiling point / range Not applicable (decomposes before boiling)
Flash point Not applicable
Evaporation rate Not applicable
Flammability (solid, gas) Not classified as flammable
Upper explosive limit Not determined
Lower explosive limit Not determined
Vapour pressure Not applicable (non-volatile solid)
Vapour density Not applicable
Relative density Not determined
Solubility in water Soluble in water
Solubility in other solvents Soluble in DMSO; sparingly soluble in ethanol
Partition coefficient (n-octanol / water) Not determined
Auto-ignition temperature Not determined
Decomposition temperature Not determined
Viscosity Not applicable
Explosive properties Not classified as explosive
Oxidising properties Not classified as oxidising
10. Stability and reactivity
Reactivity No specific reactivity hazards known under recommended storage and handling conditions.
Chemical stability Stable in the lyophilised form under recommended storage conditions (-20°C, sealed, protected from light and moisture).
Possibility of hazardous reactions No hazardous polymerisation. No hazardous reactions known under recommended conditions.
Conditions to avoid Heat, light, moisture, freeze-thaw cycles when reconstituted.
Incompatible materials Strong oxidising agents, strong acids, strong bases.
Hazardous decomposition products Thermal decomposition may yield carbon oxides (COx), nitrogen oxides (NOx) and other irritant / toxic fumes.
11. Toxicological information
11.1 Information on toxicological effects

Classification criteria not met based on available information; specific toxicological data unavailable.

12. Ecological information
Aquatic toxicity No data available.
Persistence / degradability No biodegradation data available. As a peptide composed of naturally occurring amino acids, environmental degradation may occur, but this has not been specifically evaluated.
Bioaccumulative potential Low bioaccumulation potential expected (high water solubility, peptide bond hydrolysis).
Mobility in soil No data available.
PBT/vPvB assessment Not assessed.
Other adverse effects Do not allow undiluted product or large quantities to enter ground water, watercourses or sewage systems.
13. Disposal considerations
13.1 Waste treatment methods

Product waste: Dispose of contents and container in accordance with applicable UK national and local waste regulations. Consult a licensed waste disposal contractor.

Contaminated packaging: Empty containers should be disposed of in line with local regulations. Do not reuse empty containers.

EWC waste code: Not assigned by the supplier. The end user must allocate a List of Wastes (LoW) code formerly European Waste Catalogue (EWC) - appropriate to the specific use and waste stream.

14. Transport information
Mode Status
ADR Not regulated
RID Not regulated
IMDG Not regulated
IATA / ICAO Not regulated

Environmental hazards: Not applicable
Special precautions for user: None
Transport in bulk (MARPOL): Not applicable - substance is not transported in bulk

15. Regulatory information

UK REACH: Regulation (EC) No 1907/2006 as it applies in Great Britain by virtue of the REACH etc. (Amendment etc.) (EU Exit) Regulations 2019 (SI 2019/758), as amended. This substance is not listed on the UK REACH Candidate List of Substances of Very High Concern (SVHC) and is not subject to authorisation under UK REACH Annex XIV.

UK CLP: Regulation (EC) No 1272/2008 as it applies in Great Britain by virtue of the CLP etc. (Amendment etc.) (EU Exit) Regulations 2019 (SI 2019/720), as amended. The substance does not have a harmonised classification under UK CLP Annex VI and is not classified by the supplier as hazardous.

MHRA: This product is not authorised as a medicinal product by the UK Medicines and Healthcare products Regulatory Agency (MHRA) under the Human Medicines Regulations 2012. Any supply, marketing, or use must comply with applicable UK legislation, including the Human Medicines Regulations 2012. This product is supplied solely as a chemical reagent for in vitro research.

Other UK legislation

Poisons Act 1972 Not listed under the Poisons Act 1972 (as amended).
Misuse of Drugs Act 1971 Not listed under the Misuse of Drugs Act 1971 or Misuse of Drugs Regulations 2001.

Chemical safety assessment

A Chemical Safety Assessment under UK REACH has not been carried out by the supplier.

16. Revision History
Date of issue 03.07.2026
Review Frequency As required following regulatory or technical changes.
Version 1.0
Prepared by N9 BIOTECH
17. Supporting Information

Abbreviations and acronyms

  • CAS — Chemical Abstracts Service
  • CLP — Classification, Labelling and Packaging Regulation (EC 1272/2008)
  • COA — Certificate of Analysis
  • ECHA — European Chemicals Agency
  • GHS — Globally Harmonised System of Classification and Labelling of Chemicals
  • IATA — International Air Transport Association
  • IARC — International Agency for Research on Cancer
  • IMDG — International Maritime Code for Dangerous Goods
  • LoW — List of Wastes (UK; formerly European Waste Catalogue)
  • MHRA — Medicines and Healthcare products Regulatory Agency (UK)
  • NPIS — National Poisons Information Service (UK)
  • NTP — National Toxicology Program (USA)
  • OEL — Occupational Exposure Limit
  • PBT — Persistent, Bioaccumulative and Toxic
  • PPE — Personal Protective Equipment
  • REACH — Registration, Evaluation, Authorisation and Restriction of Chemicals (EC 1907/2006)
  • RUO — Research Use Only
  • SDS — Safety Data Sheet
  • STOT-SE — Specific Target Organ Toxicity, Single Exposure
  • STOT-RE — Specific Target Organ Toxicity, Repeated Exposure
  • SVHC — Substance of Very High Concern
  • vPvB — very Persistent and very Bioaccumulative
  • WEL — Workplace Exposure Limit

References

  • ECHA Classification & Labelling Inventory — substance not listed as classified
  • PubChem (NCBI) — chemical identity database (CAS, molecular formula, IUPAC name)
  • Regulation (EC) No 1907/2006 (REACH) as retained in UK law
  • Regulation (EC) No 1272/2008 (CLP) as retained in UK law
  • UK MHRA — Human Medicines Regulations 2012

The information in this Safety Data Sheet is provided in good faith and is believed to be correct as of the date of issue. N9 BIOTECH makes no warranty, express or implied, regarding the accuracy of this data or the results to be obtained from its use. This product is supplied for research use only (in vitro). The user assumes all responsibility for the safe use, handling, storage and disposal of the product, and for compliance with all applicable laws and regulations. This SDS does not constitute a quality specification — quality data is supplied separately on the Certificate of Analysis.

This document is provided for occupational safety and transport reference purposes only and does not constitute product approval, authorisation, or suitability for any specific application.

This document will be reviewed periodically and updated where new regulatory, safety, or technical information becomes available.

 

End of Safety Data Sheet  •  Browse Additional Safety Data Sheets

About Us | N9 BIOTECH